PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01451g02003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 700aa    MW: 76693.3 Da    PI: 6.6875
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01451g02003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093884251954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf01451g02003.1 388 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 425
                               554458******************************88 PP

2BELL113.51.1e-36252323172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               erqe+q+kkakL+++l+eV++rY++y++q+q vis  e++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Niben101Scf01451g02003.1 252 ERQEIQMKKAKLVNMLDEVEQRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQI 323
                               79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-55177321IPR006563POX domain
PfamPF075264.0E-46186320IPR006563POX domain
PROSITE profilePS5007112.001366429IPR001356Homeobox domain
CDDcd000866.23E-12369430No hitNo description
SMARTSM003891.9E-9369433IPR001356Homeobox domain
SuperFamilySSF466891.11E-16370435IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28372435IPR009057Homeodomain-like
PfamPF059203.8E-18386425IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MAAYFHGNSE IQEGNDGLQT LLLMNPAGYV GFSETQHHQQ PAAEGSNLVF FNSNPPGNSL  60
NLPHAPPSSQ QQFVGIPLAT SAFTAPSSSQ GGTTTPTVHS HHDISALHGF LPRSHEYGFY  120
NPSSDITEAR EVTRAQQQGL SLSLSSQQPR FGNFRPEHEE LMTSVSPTAG GGSSSASAVQ  180
SVPLSPKYLK AAQELLDEVV NVGKAVKTST TDEDFIDGQK SKINGESSGN MATAGQGGES  240
SNRDGAELST AERQEIQMKK AKLVNMLDEV EQRYRHYHQQ MQSVISWLEQ AAGIGSAKTY  300
TALALQTISK QFRCLKDAIT GQIRSASKTL GEEDSFGGKI EGSRLKFVDN QIRQQRALQQ  360
LGMIQHNAWR PQRGLPERAV SFLRAWLFEH FLHPYPKDSD KMMLAKQTGL TRSQVSNWFI  420
NARVRLWKPM VEEMYLEEIK EQEQNGSDVK KTNKLGEQNE DSTSRSIAPQ EKSPGSDSQN  480
KSFLSKQDNN LENLNPASTI PMSNSTSISP AGLSIRNNTG FNLIGSPEIK RINIGQGSPK  540
KPRSNEMLHS PNSVPSINMD VKPNEEQMLI KFGDDRQNRD GFSLMGGPTN FMAGFGSYPI  600
GEIGRFSTEQ FSAPYSTSGT VSLTLGLPHT ENLSMSATHH SFLPIPTQSI QIGRGVEIDE  660
ANEFGSLNTP TSAHSTSVYE NFNIQNRKRF AAPLLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16375433563Homeobox protein Meis2
3k2a_B4e-16375433563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787674.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787673.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787672.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480179.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480178.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480177.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-162BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM1BX380.0M1BX38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000549450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-150BEL1-like homeodomain 1